PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G353000.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bHLH
Protein Properties Length: 205aa    MW: 22941.2 Da    PI: 8.6682
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G353000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH438.4e-141769155
                        CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                 HLH  1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                        ++ +hn+ Er RR+++N+ ++ Lr++lP++  ++ k+ls  +++ +  +YI +Lq
  Gorai.007G353000.2 17 KKLNHNASERVRRRKMNDLYSSLRSMLPPS--EQTKRLSIPATVSRMLKYIPELQ 69
                        6789*************************7..36666***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000832.95E-121573No hitNo description
SuperFamilySSF474591.44E-141583IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088814.2721668IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.107.0E-111782IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000106.3E-111769IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003533.1E-82274IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MFSAGDTGDE NPTTVDKKLN HNASERVRRR KMNDLYSSLR SMLPPSEQTK RLSIPATVSR  60
MLKYIPELQL QVEILLQKKQ QILSTICKQD DHDLSNQHHQ NKTKLSDGFK VSPFTVSGTK  120
VTDTEATIQI STFGPTSQGI PPLSPILRGL EEDGLFLTDA SCFESFGGRV FYNLNFQVET  180
TYNLEAMLLV LNEKLLSLYK KGKA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5858603e-45JX585860.1 Gossypium hirsutum clone NBRI_GE19536 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012434883.11e-150PREDICTED: transcription factor ORG2-like isoform X2
TrEMBLA0A0D2PJI41e-111A0A0D2PJI4_G
STRINGGLYMA03G28630.12e-54(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.13e-47bHLH family protein